PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G233500.1
Common NameB456_008G233500, LOC105765086
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 325aa    MW: 35335.9 Da    PI: 6.7033
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G233500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.26.8e-1293137347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
  Gorai.008G233500.1  93 PWTEEEHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKY 137
                         8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.106.1E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.286142IPR017930Myb domain
SuperFamilySSF466897.48E-1788143IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-1989141IPR006447Myb domain, plants
SMARTSM007171.9E-1090140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-1190136IPR009057Homeodomain-like
CDDcd001676.58E-993138No hitNo description
PfamPF002492.5E-1093137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL TDGLVRKSAS MSNLSQFAGS NSAGHNGNGS  60
GSPGEGPDHA DGYASEDFVP GSSSSRDRKK GVPWTEEEHR MFLLGLQKLG KGDWRGISRN  120
YVISRTPTQV ASHAQKYFIR QSNVSRRKRR SSLFDIVADE SGDTPMVSPD LFTANHPLDE  180
TQSTDQLPIP PPLDEEDESM DSNNSNDGEP VPHPTSEISE PCYPVVYPAY FPPFYPFSFP  240
YWMGYNTEPT KTDTHEVVKP TAVHSKSPIN VDELVGMSKL SLGESIGDNG PSSLSLKLDG  300
SSRQSAFHAN PSSRNSSGSP IHAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.28250.0seedling
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3887311e-64FQ388731.1 Vitis vinifera clone SS0AEB22YC13.
GenBankFQ3920351e-64FQ392035.1 Vitis vinifera clone SS0AFA7YN06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439456.10.0PREDICTED: myb-like protein J
SwissprotQ2V9B05e-37MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0D2TBD20.0A0A0D2TBD2_G
STRINGPOPTR_0001s15510.11e-171(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34262759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-113MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]